SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050292 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050292
Domain Number 1 Region: 150-236
Classification Level Classification E-value
Superfamily PDB 1.24e-31
Family PDB 0.0056
Further Details:      
 
Domain Number 2 Region: 29-96
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.21e-30
Family Double-stranded RNA-binding domain (dsRBD) 0.0018
Further Details:      
 
Domain Number 3 Region: 159-222
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.42e-28
Family Double-stranded RNA-binding domain (dsRBD) 0.0003
Further Details:      
 
Domain Number 4 Region: 293-360
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000346
Family Double-stranded RNA-binding domain (dsRBD) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050292   Gene: ENSPTRG00000005020   Transcript: ENSPTRT00000009241
Sequence length 366
Comment pep:known chromosome:CHIMP2.1.4:12:35744938:35750444:-1 gene:ENSPTRG00000005020 transcript:ENSPTRT00000009241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQP
NFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPE
DIPVFTAAAAATPVPSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTV
TQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEP
DDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSE
LSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLK
IMAGSK
Download sequence
Identical sequences G1S7H6 H2R7F2 Q15633
ENSNLEP00000021465 ENSNLEP00000021465 ENSPTRP00000050292 ENSP00000266987 HR4698 ENSP00000266987 5zak_B 5zal_B 5zam_B gi|19743840|ref|NP_599150.1| ENSPTRP00000050292 NP_599150.1.87134 NP_599150.1.92137 XP_003313703.1.37143 XP_003831059.1.60992 9606.ENSP00000266987 ENSP00000266987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]