SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050378 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000050378
Domain Number - Region: 36-106
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000926
Family Snake venom toxins 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050378   Gene: ENSPTRG00000041074   Transcript: ENSPTRT00000057494
Sequence length 200
Comment pep:novel chromosome:CHIMP2.1.4:6:31951837:31954132:1 gene:ENSPTRG00000041074 transcript:ENSPTRT00000057494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFWLVEDPSVGCISVSEKCTISSSSLCMVITI
YYDVKVCFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQRQSSLPEPH
DRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELCRMYL
FLNSSGLLVLPQAGLTPHPS
Download sequence
Identical sequences H2R7H1
ENSPTRP00000050378 ENSPTRP00000050378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]