SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051348 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051348
Domain Number 1 Region: 670-985
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.89e-57
Family WD40-repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 352-474
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000144
Family Prefoldin 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000051348
Domain Number - Region: 293-376
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0199
Family BAR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051348   Gene: ENSPTRG00000001825   Transcript: ENSPTRT00000003314
Sequence length 1004
Comment pep:known chromosome:CHIMP2.1.4:1:179726584:179751222:-1 gene:ENSPTRG00000001825 transcript:ENSPTRT00000003314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEPDCAPVEVNFQADLADLTCEIEIKQKLIDELENSQRRLQTLKHQYEEKLILLQNKIRD
TQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNRDLQKLQAAQKEHARLLKNQSR
YERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETKRNREIAQLKKEQRRQEFQIRA
LESQKRQQEMVLRRKTQEVSALRRLAKPMSERVAGRAGLKPPMLDSGAEVSASTTSSEAE
SGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKKFQKKGASQSFSKAARLKWQSLE
RRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALRRKRERLQAESPEEEKGLQELAE
EIEVLAANIDYINDSITDCQATIVQLEETKEELDSTDTSVVISSCSLAEARLLLDNFLKA
SIDKGLQVAQKEAQIRLLEGRLRQTDMAGSSQNHLLLDALREKAEAHPELQALIYNVQQE
NGYASTDEEISEFSEGSFSQSFTMKGSTSHDDFKFKSEPKLSAQMKAVSAECLGPPLDIS
TKNITKSLASLVEIKEDGVGFSVRDPYYRDRVSRTVSLPTRGSTFPRQSRATETSPLTRR
KSYDRGQPIRSTDVGFTPPSSPPTRPRNDRNVFSRLTSNQSQGSALDKGIISPVGGAKGA
RTAPLQCVSMAEGHTKPILCLDATDELLFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVS
IKYCSHSGLVFSVSTSYIKVWDIRDSAKCIRTLTSSGQVISGDACAATSTRAITSAQGEH
QINQIALSPSGTMLYAASGNAVRIWELSRFQPVGKLTGHIGPVMCLTVTQTASQHDLVVT
GSKDHYVKMFELGECVTGTIGPTHNFEPPHYDGIECLAIQGDILFSGSRDNGIKKWDLDQ
QELIQQIPNAHKDWVCALAFIPGRPMLLSACRAGVIKVWNVDNFTPIGEIKGHDSPINAI
CTNAKHIFTASSDCRVKLWNYVPGLTPCLPRRVLAIKGRATTLP
Download sequence
Identical sequences ENSPTRP00000051348 ENSPTRP00000051348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]