SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051373 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051373
Domain Number 1 Region: 766-1068,1108-1162,1206-1261
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.92e-69
Family Calponin-homology domain, CH-domain 0.002
Further Details:      
 
Domain Number 2 Region: 1524-1613
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000281
Family Motor proteins 0.061
Further Details:      
 
Domain Number 3 Region: 1705-1791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000743
Family Motor proteins 0.054
Further Details:      
 
Domain Number 4 Region: 1792-1864
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000929
Family Motor proteins 0.026
Further Details:      
 
Domain Number 5 Region: 1258-1374
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000637
Family Motor proteins 0.046
Further Details:      
 
Domain Number 6 Region: 1622-1709
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000797
Family Motor proteins 0.038
Further Details:      
 
Domain Number 7 Region: 1865-1941
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000231
Family Motor proteins 0.064
Further Details:      
 
Domain Number 8 Region: 1464-1528
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000425
Family Motor proteins 0.042
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000051373
Domain Number - Region: 1944-2016
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000584
Family Motor proteins 0.081
Further Details:      
 
Domain Number - Region: 1364-1414
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0478
Family Motor proteins 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051373   Gene: ENSPTRG00000001807   Transcript: ENSPTRT00000003276
Sequence length 2025
Comment pep:known chromosome:CHIMP2.1.4:1:175788897:175841858:-1 gene:ENSPTRG00000001807 transcript:ENSPTRT00000003276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRRVGRGCWEVSPTERRPPAGLRGPAAEEEASSPPVLSLSHFCRSPFLCFGDVLLGAS
RTLSLALDNPNEEVAEVKISHFPAADLGFSVSQRCFVLQPKEKIVISVNWTPLKEGRVRE
IMTFLVNDVLKHQAILLGNAEEQKKKKRSLWDTIKKKKISASTSHNRRVSNIQNVNKTFS
VSQKVDRVRSPLQACENLAMNEGGPPTENNSLILEENKIPISPISPAFNECHGATCLPLS
VRRSTTYSSLHASENRELLNVHSANVSKVSFNEKAVTETSFNSVNVNGQSGENSKLSLTP
NYSSTLNITQSQTHFLSPDSFVNNSHGANNELELVTCLSSDMFMKDNSKPVHLESTIAHE
IYQKILSPDSFIKDNYGLNQDLESESVNPILSPNQFLKDNMAYMCTSQQTCKVPLSNENS
QVPQSPEDWRKSEVSPRIPECQGSKSPKAIFEELVEMKSNYYSFIKQNNPKFSAVQDISS
HSHNKQPKRRPILSATVTKRKATCTRENQTEINKPKAKRCLNSAVGEHEKVINNQKEKED
FHSYLPIIDPILSKSKSYKNEVTPSSTTASVARKRKSDGSMEDGNVRGAITEHTEVREIK
RIHFSPSEPKTSAVKKTKNVITPISKRISNREKLNLKKKTDLSIFRTPISKTNKRTKPII
AVAQSSLTFIKPLKTDIPRHPMPFAAKNMFYDERWKEKQEQGFTWWLNFILTPDDFTVKT
NISEVNAATLLLGIENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVK
AIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLED
NSDVTGLAMFILNRLLWNPDIAAEYRHPSVPHLYRDGHEEVLSKFTLKKLLLLVCFLDYA
KISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDE
FDFAVTNLAVDLQCGVRLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKSRG
IELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIK
KTISLLSCHSDDLINKKKGKRDCGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSD
GRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHE
NTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARL
LDLRKEIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAAL
VIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQGYWRRYSTRQRFLKLKYYSIILQSR
IRMIIAVTSYKRYLWATVTIQRHWRAYLRRKQDQQRYEMLKSSTLIIQSMFRKWKQRKMQ
SQVKATVILQRAFREWHLRKQAKEQNSAIIIQSWYRMHKELRKYIYIRSCVVIIQKRFRC
FQAQKLYKRKKESILTIQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRRLKAHNLYRQI
RAACVIQSYWRMRQDRVRFLNLKKTIIKLQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYI
FAMKVLASYQKIRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKN
ATIKLQSIVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVR
GYLVRKQMRLRRKAVISLQSYFRMRKAQQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQ
VKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRA
YKTLHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLF
KTAALVIPQNGRAWTAGRKQRMEYIELRHAVLMLQSMWKGKTLRRQLQRQHKCAIIIQSY
YRMXXXXXXXXXXKSAALIIQKYIRAREAGKRERIKYIEFKKSTV
Download sequence
Identical sequences ENSPTRP00000051373 ENSPTRP00000051373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]