SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051454 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051454
Domain Number 1 Region: 304-543
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.42e-70
Family Nuclear receptor ligand-binding domain 0.000000000647
Further Details:      
 
Domain Number 2 Region: 102-187
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-31
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051454   Gene: ENSPTRG00000007134   Transcript: ENSPTRT00000013167
Sequence length 555
Comment pep:known chromosome:CHIMP2.1.4:15:57865991:58008232:-1 gene:ENSPTRG00000007134 transcript:ENSPTRT00000013167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEGAPGDSDLETEARVLWSIMGHCLTGQARISATPTPAGEGARRDELFGILQILHQCIL
SSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNAQIEIIPCKICGDKSSGIHYGVI
TCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRM
SKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHT
PEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTV
SMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKIT
EAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASP
DVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQK
IQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYK
ELFTSEFEPAMQIDG
Download sequence
Identical sequences A0A2I3TCT2
ENSPTRP00000051454 9598.ENSPTRP00000051454 ENSPTRP00000051454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]