SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051711 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051711
Domain Number 1 Region: 924-1051,1083-1288
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.33e-67
Family p120GAP domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 26-190
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.24e-38
Family Calponin-homology domain, CH-domain 0.0000263
Further Details:      
 
Domain Number 3 Region: 1504-1601
Classification Level Classification E-value
Superfamily RGC domain-like 1.83e-30
Family RGC domain 0.0000107
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000051711
Domain Number - Region: 639-668
Classification Level Classification E-value
Superfamily WW domain 0.000222
Family WW domain 0.0027
Further Details:      
 
Domain Number - Region: 693-758
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000885
Family Motor proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051711   Gene: ENSPTRG00000001461   Transcript: ENSPTRT00000002691
Sequence length 1601
Comment pep:known chromosome:CHIMP2.1.4:1:134823653:134870268:-1 gene:ENSPTRG00000001461 transcript:ENSPTRT00000002691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRAAGPGRAAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEE
SLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAIAHIGLPS
TFFPETTDIYDKKNMPRVVYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELA
KYGLQLPAFSKIGGILANELSVDEAAVHAAVLAINEAVERGVVEDTLAALQNPSALLENL
QEPLAAVYQEMLAQAKMEKAANARNHDDRESQDIYDHYLTQAEIQGNINHVNVHGALEVV
DDALERQSPEALLKALQDPALALRGVRRDFADWYLEQLNSDREQKAQELGLVELLEKEEV
QAGVAAANTKGDQEQAMLHAVQRINKAIRRGVAADTVKELMCPEAQLPPVYPVASSMYQL
ELAVLQQQQQGELGQEELFVAVEMLSAVVLINRALEARDASGFWSSLVNPATGLAEVEGE
NAQRYFDALLKLRQERGMGEEFLSWNDLQATVSQVNAQTQEETDRVLAVSLINEALDKGS
PEKTLSALLLPAAGLDDVSLPVAPRYHLLLVAAKRQKAQALGVAAINQAIKEGKAAQTER
VLRNPAVALRGVVPDCANGYQRALESAMAKKQRPADTAFWVQHDMKDGTAYYFHLQTFQG
IWEQPPGCPLNTSHLTREEIQSAVTKVTAAYDRQQLWKANVGFVIQLQARLRGFLVRQKF
AEHSHFLRTWLPAVIKIQAHWRGYRQRKIYLEWLQYFKANLDAIIKIQAWARMWAARRQY
LRRLHYFQKNVNSIVKIQAFFRARKAQDDYRILVHAPHPPLSVVRRFAHLLNQSQQDFLA
EAELLRLQEEVVRKIRSNQQLEQDLNIMDIKIGLLVKNRITLQEVVSHCKKLTKRNKEQL
SDMMVLDKQKGLKSLSKEKRQKLEAYQHLFYLLQTQPIYLAKLIFQMPQNKTTKFMEAVI
FSLYNYASSRREAYLLLQLFKTALQEEIKSKVEQPQDVVTGNPTVVRLVVRFYRNGRGQS
ALQEILGKVIQDVLEDKVLSVHTDPVHLYKNWINQTEAQTGQRSHLPYDVTPEQALSHPE
VQRRLDIALRNLLAMTDKFLLAITSSVDQIPYGMRYVAKVLKATLAEKFPDATDSEVYKV
VGNLLYYRFLNPAVVAPDAFDIVAMAAGGALAAPQRHALGAVAQLLQHAAAGKAFSGQSQ
HLRVLNDYLEETHLPKRKFIHRACQVPEPEERFAVDEYSDMVAVAKPVVYITVGELVNTH
RLLLEHQDCIAPDHQDPLHELLEDLGELPTIPDLIGESIAADGHTDLSKLEVSLTLTNKF
EGLEADADDSNTRSLLLSTKQLLADIIQFHPGDTLKEILSLSASREQEAAHKQLMSRRQA
CTAQTPEPLRRHRSLTAHSLLPLAEKQRRVLRNLRRLEALGLVSTRNGYQGLVDELAKDI
RNQHRHRHRRKAELVKLQATLQGLSTKTTFYEEQGDYYSQYIRACLDHLAPDSKSSGKGK
KQPSLHYTAAQLLEKGVLVEIEDLPASHFRNVIFDITPGDEAGKFEVNAKFLGVDMERFQ
LHYQDLLQLQYEGVAVMKLFNKAKVNVNLLIFLLNKKFLRK
Download sequence
Identical sequences ENSPTRP00000051711 ENSPTRP00000051711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]