SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051970 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051970
Domain Number 1 Region: 153-417,444-483
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.44e-81
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000393
Further Details:      
 
Domain Number 2 Region: 3-72,100-144
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000000012
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051970   Gene: ENSPTRG00000001043   Transcript: ENSPTRT00000058914
Sequence length 536
Comment pep:known chromosome:CHIMP2.1.4:1:109943115:109968116:1 gene:ENSPTRG00000001043 transcript:ENSPTRT00000058914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAE
RIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKR
KNNLHLSTQNKLEASLFSPKKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKE
FMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDITLENRLQNMEVTDA
Download sequence
Identical sequences A0A2I3TN97
ENSPTRP00000051970 ENSPTRP00000051970 XP_008958682.1.60992 XP_009425317.1.37143 9598.ENSPTRP00000051970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]