SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052114 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052114
Domain Number 1 Region: 15-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-91
Family Protein kinases, catalytic subunit 0.000000497
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000052114
Domain Number - Region: 425-464
Classification Level Classification E-value
Superfamily NAP-like 0.0458
Family NAP-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052114   Gene: ENSPTRG00000013533   Transcript: ENSPTRT00000025187
Sequence length 475
Comment pep:known chromosome:CHIMP2.1.4:20:41946002:42053751:1 gene:ENSPTRG00000013533 transcript:ENSPTRT00000025187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK
EISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQS
TLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMA
PEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSD
NFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDVKLKRQESQQREV
DQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINA
EDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKETQINSFGKSVPGPLKNSSDWKIPQDGD
YEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF
Download sequence
Identical sequences A4K2N7
ENSPTRP00000052114 ENSPTRP00000052114 9598.ENSPTRP00000052114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]