SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052123 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052123
Domain Number 1 Region: 28-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000129
Family Growth factor receptor domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000052123
Domain Number - Region: 192-237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000116
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052123   Gene: ENSPTRG00000013526   Transcript: ENSPTRT00000059037
Sequence length 250
Comment pep:known chromosome:CHIMP2.1.4:20:41689345:41702408:1 gene:ENSPTRG00000013526 transcript:ENSPTRT00000059037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRL
GEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIR
CRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQ
FSGLVSSLPPGVPCPEWSTAWGSCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPS
RGRSPQNSAF
Download sequence
Identical sequences H2R8X7
XP_009435562.1.37143 ENSPTRP00000052123 9598.ENSPTRP00000052123 ENSPTRP00000052123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]