SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052273 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052273
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.51e-51
Family Calponin-homology domain, CH-domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 194-254
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.45e-21
Family EB1 dimerisation domain-like 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052273   Gene: ENSPTRG00000013385   Transcript: ENSPTRT00000024860
Sequence length 268
Comment pep:known chromosome:CHIMP2.1.4:20:29569602:29600313:1 gene:ENSPTRG00000013385 transcript:ENSPTRT00000024860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSDNLSRHDMVGWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY
Download sequence
Identical sequences ENSPTRP00000052273 9598.ENSPTRP00000052273 ENSPTRP00000052273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]