SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052464 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052464
Domain Number 1 Region: 1-289
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-84
Family Protein kinases, catalytic subunit 0.00000914
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052464   Gene: ENSPTRG00000006738   Transcript: ENSPTRT00000012413
Sequence length 419
Comment pep:known chromosome:CHIMP2.1.4:14:101932515:102003348:-1 gene:ENSPTRG00000006738 transcript:ENSPTRT00000012413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPH
PNILMLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIH
RNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYT
YKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKTLTKFKQSRAMNFDFP
FKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR
KAGFPEHPVAPEPLSNSCQISKEGRKQKQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRL
SSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPRKDLKPAPQQCRLPTIARKGGR
Download sequence
Identical sequences H2R960
ENSPTRP00000052464 ENSPTRP00000052464 XP_009426664.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]