SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052575 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052575
Domain Number 1 Region: 969-1051
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 678-737
Classification Level Classification E-value
Superfamily BPTI-like 8.51e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0025
Further Details:      
 
Domain Number 3 Region: 1055-1142
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-18
Family I set domains 0.048
Further Details:      
 
Domain Number 4 Region: 233-291
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000017
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 5 Region: 297-355
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000275
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 6 Region: 27-75
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000942
Family TSP-1 type 1 repeat 0.00086
Further Details:      
 
Domain Number 7 Region: 417-469
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 8 Region: 354-411
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 846-915
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000171
Family I set domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052575   Gene: ENSPTRG00000006512   Transcript: ENSPTRT00000011939
Sequence length 1198
Comment pep:novel chromosome:CHIMP2.1.4:14:72486753:72523799:1 gene:ENSPTRG00000006512 transcript:ENSPTRT00000011939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLLVPLLLAPAPGSSAPKVRRQSDTWGPWGQWSPCSRTCGGGVSFRERPCYSQRRDG
GSSCVGPARSHRSCRTESCPDGARDFRAEQCAEFDGAEFQGRRYRWLPYYSAPNKCELNC
IPKGENFYYKHREAVVDGTPCEPGKRDVCVDGSCRVKNVRGEYYLNGHWTIEAAQALPAA
STILHYERGAEGDLAPEQLHARGPTSEPLVIELISQEPNPGVHYEYHLPLRRPGPGFSWS
HGSWSDCSAECGGGHQSRLVFCTIDHEAYPDHMCQRQPRPADRRSCNLHPCPETKRWKAG
PWAPCSASCGGGSQSRSVYCISSDGAGIQEAVEEAECAGLPGKPPAIQACNLQRCAAWSP
EPWGECSVSCGVGVRKRSVTCRGERGSLLHTAACSLEDRPPLTEPCVHEDCPLLSDQAWH
VGTWGLCSKSCSSGTRRRQVVCAIGPPSHCGSLQHSKPVDVEPCNTQPCHLPQEVPSMQD
VHTPASNPWMPLGPQESPASDSRGQWWAAQEHPSARGDHRGERGDPRGDQGTHLSALGPA
PSLQQPPYQQPLWSGSGPHDCRHSPHGCCPDGHTASLGPQWQGCPGAPCQQSRYGCCPDR
VSVAEGPHHAGCTKSYGGDSTGGRPRSRAVASTVHNTHQPQAQQNEPSECRGSQFGCCYD
NVATAAGPLGEGCVGQPSHAYPVRCLLPSAHGSCADWAARWYFVASVGQCNRFWYGGCHG
NANNFASEQECMSSCQGSLHGPRRPQLEASGRSTHTDGGGSSPAGEQEPSQHSTGATVQR
KPWPSGGLWRQDQQPGPGEAPHTQAFGEWPWGQELGSRAPGLGGDAGSPAPPFHSSSYRI
SLAGVEPSLVQAALERLVRLSCSDDTAPPTSSDRHRLQSDGSLIIHPLQAEDAGTYSCGS
TRPGRDSQKIQLRIIGGDMAVLSEAELSRFPQPRDPAQDFGQAGAAGPLGAIPSSHPQPA
NRLRLDQNQPRVVDASPGQRIRMTCRAEGFPPPAIEWQRDGQPVSSPRHQLQPDGSLVIS
RVAVEDGGFYTCVAFNGQDRDQRWVQLRVLGELTISGLPPTVTVPEGDTARLLCVVAGES
VNIRWSRNGLPVQADGHRVHQSPDGTLLIYNLRARDEGSYTCSAYRGSQAVSRSTEVKVV
SPAPTAQPRDPGRDCVDQPELANCDLILQAQLCGNEYYSSFCCASCSRFQPHAQPIWQ
Download sequence
Identical sequences ENSPTRP00000052575 ENSPTRP00000052575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]