SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052596 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052596
Domain Number 1 Region: 474-532,574-672
Classification Level Classification E-value
Superfamily PH domain-like 2.16e-31
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 2 Region: 678-805
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-20
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Domain Number 3 Region: 1092-1224
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-18
Family Second domain of FERM 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000052596
Domain Number - Region: 993-1070
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00031
Family Ubiquitin-related 0.055
Further Details:      
 
Domain Number - Region: 38-128,579-599
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000607
Family BAR domain 0.05
Further Details:      
 
Domain Number - Region: 1228-1286
Classification Level Classification E-value
Superfamily PH domain-like 0.0162
Family Third domain of FERM 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052596   Gene: ENSPTRG00000006465   Transcript: ENSPTRT00000011842
Sequence length 1363
Comment pep:known chromosome:CHIMP2.1.4:14:66679053:66728509:1 gene:ENSPTRG00000006465 transcript:ENSPTRT00000011842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELKVEAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDSEGSLHRKYQELLKAIKGKDELISQLEAQLEKQKQMRAEE
AKTVQEKAAKIKEWVTLKLAELEMENQHLKSHNQRLVEQVGSLQDALEAIQIAPSRKLLV
PPHGAAEQDSVPSEPGIQPMGQDSGSQAQGLKAAVLAPSPGALQSKDSVSEAASPLEDSS
SSTVHSGETVEAKPLQPHLGRESPPHQPCMKLLTFRCSSASWGEGLVTAQRGMLPGTKTS
AREGGPGSSLTLPKVRAPGTPRDSIQLAKRHHSQPQVGHGHFGRVVNIETEAFSALHPSG
LPELESRARYREEPEKMEMEEPPPAGKNEERESPKALGAELEEVELGNKPPTPPLHQFSS
WESRIYAVATSGMRLSDVSPRSNTACCASSPPALVSPGSFSGLVYKNVTVPVYTLKGRAT
QISNMPFMDESSGSDDDCSSQASFRISVPSSESRKTSGLGSPRAIKRGVSMSSLSSEGDY
AIPPDACSLDSDYSEPEHKLQRTSSYSTDGLGLGGESLEKSGYLLKMGSQVKTWKRRWFV
LRQGQIMYYKSPSDVIRKPQGQVDLNSRCQIVRGEGSQTFQLISEKKTYYLTADSPSLLE
EWIRVLQSLLKVQATGPPALLRGGTKPTVKGWLTKVKHGHSKVVWCALVGKTFYYYRSHE
DKRPLGCLPVRDARIEEVDRSCDSDEDYEAGGTRRLLSSHCTLVIHPTEHSPTYLLIGTK
HEKDTWLYHLTVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYASL
TTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQL
MKQTSCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYATYCQ
RAVERTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYQVVGFDGSSTVDE
FLQRLNQEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKELHPGKS
EGGTRVAKLMYKNRLYFRSQVKGETDRERLLLASQTSREIVAGRFPVNKELALEMAVLMA
QVEYGDLEKPALPGPGGTSPAKAQHLLQQVLDRFYPRRYRHGAPPEQLRHLADMLTTKWA
TLQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQLSSKENALVWIAVNEDGVSILDHTT
MQVHITYPYSSVTTFGGCRDDFMLVIRSIPDKSSGKSHIEKLIFRMAAPKIAEATFIMAS
YMNHCTTTVNPPTNPPGACQLWELDGRQFFSSVSCATKGPTLL
Download sequence
Identical sequences ENSPTRP00000052596 ENSPTRP00000052596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]