SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052916 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052916
Domain Number 1 Region: 6-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.4e-61
Family BAR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 252-445
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.08e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052916   Gene: ENSPTRG00000008787   Transcript: ENSPTRT00000016184
Sequence length 812
Comment pep:known chromosome:CHIMP2.1.4:17:43050505:43255153:-1 gene:ENSPTRG00000008787 transcript:ENSPTRT00000016184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGA
EADKRSKKLPLTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFELQVERDV
IEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALR
EEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQI
KAQQEAWVEKPSFGKPLEEHLPISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLK
KLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQEQDKKL
QALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNIT
EMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPA
DRRQPEQARRPLSVATDNMMLEFYKKDGMGVRVMDTNWVARRGSSAGRKVSCAPPSMQPP
APPAELAAPLPSPLPEQPLDSPAAPALSPSGLGLQPGPERTSTTKSKELSPGSAQKGSPG
SSQGTACAGTQPGAQPGAQPGASPSPSQPPADQSPHTLRKVSKKLAPIPPKVPFGQPGAM
ADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKS
RPTPKPRQRPTLPPPQPPTVNLSASSPQSTEPPMLDGMSPGESMSTDLVHFDIPSIHIEL
GSTLRLSPLEHMRRHSVTDKRDSEEESESTAL
Download sequence
Identical sequences ENSPTRP00000052916 ENSPTRP00000052916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]