SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053014 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053014
Domain Number 1 Region: 7-226
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.33e-47
Family Protein kinases, catalytic subunit 0.0000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053014   Gene: ENSPTRG00000020666   Transcript: ENSPTRT00000038217
Sequence length 301
Comment pep:known chromosome:CHIMP2.1.4:8:142620298:142626524:1 gene:ENSPTRG00000020666 transcript:ENSPTRT00000038217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTAVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVVRAENDRDIYLVFEFMYTLGVDMWSLGCILGEMLRGRPLFP
GTSTLHQLEVILETIPPPSEEDLLALGSGCRASVLHHLGSRPRQTLDALLPPDTSPEALD
LLRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRV
YQMILECGGSSGTSREKGPEGVSPSQAHLHKPRADPQLPSRTPVQGPRPRSQSSPHDPAE
H
Download sequence
Identical sequences ENSPTRP00000053014 9598.ENSPTRP00000053014 ENSPTRP00000053014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]