SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053202 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053202
Domain Number 1 Region: 850-928
Classification Level Classification E-value
Superfamily DEATH domain 4.04e-19
Family DEATH domain, DD 0.0000628
Further Details:      
 
Domain Number 2 Region: 161-252
Classification Level Classification E-value
Superfamily Immunoglobulin 5.75e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 251-301
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000562
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 307-354
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 54-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000278
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053202   Gene: ENSPTRG00000020154   Transcript: ENSPTRT00000059933
Sequence length 953
Comment pep:known chromosome:CHIMP2.1.4:8:31716183:32276426:1 gene:ENSPTRG00000020154 transcript:ENSPTRT00000059933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAAATAGGGGGARRWLPWLGLCFWAAGTAAARGTDNGEALPESIPSAPGTLPHFIEEP
DDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTR
QQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHC
RPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKR
RSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKIT
CTSLCPVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCI
LDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSAL
TGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSD
IKVKVQSSFMVSLGVSERAEYHGKNHSRTFPHGNNHSFSTMHPRNKMPYIQNLSSLPTRT
ELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLS
PEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCL
LDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAF
QEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWC
SNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDS
TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAV
ILNLWEARHQHDGDLDSLACALEEIGRTHTKLSNISESQLDEADFNYSRQNGL
Download sequence
Identical sequences A0A2J8N818 Q6UXZ4
ENSP00000385143 NYSGRC-IgSF-UNC5D_HUMAN 9598.ENSPTRP00000053202 9606.ENSP00000385143 gi|209977117|ref|NP_543148.2| ENSPTRP00000053202 ENSP00000385143 ENSPTRP00000053202 NP_543148.2.87134 NP_543148.2.92137 XP_528109.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]