SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053380 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053380
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.81e-25
Family Cofilin-like 0.00000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053380   Gene: ENSPTRG00000008419   Transcript: ENSPTRT00000015520
Sequence length 88
Comment pep:known chromosome:CHIMP2.1.4:16:84198661:84223014:-1 gene:ENSPTRG00000008419 transcript:ENSPTRT00000015520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVI
SDRKELEEDFIKSELKKAGGANYDAQTE
Download sequence
Identical sequences ENSPTRP00000053380 ENSMICP00000002024 ENSPTRP00000053380 ENSFCAP00000010060 ENSMICP00000002024 9598.ENSPTRP00000053380 9685.ENSFCAP00000010060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]