SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053487 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053487
Domain Number 1 Region: 343-389
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053487   Gene: ENSPTRG00000005901   Transcript: ENSPTRT00000060174
Sequence length 710
Comment pep:known chromosome:CHIMP2.1.4:13:52109076:52134466:-1 gene:ENSPTRG00000005901 transcript:ENSPTRT00000060174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPMLKDFSNLLLVVLCDYVLGEAEYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVS
VLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKS
AFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARR
NSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKF
GYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERR
TIFNCTLFDMGKNKYCFDFGISSRSHFSAKEKECMLIQRNKETWELWQPWSQCSATCGDG
VRERRRVCLTSFPSSPVCPGMSLEASLCSLEECAAFQPSSPSPLQPQGPVKSNNIVTVTG
ISLCLFIIIATVLITLWRRFGRPAKCSTPARHNSIHSPSFRKNSDEENICELSEQRGSFS
DGGDGPTGSPRDTGIPLTYRRSGPVPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKE
MKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSA
GERPPSRLDLNVTQASCAISPSQTLIRKSQARHVGSRGGPSERSHARKPHFRRTASFHEA
RQAHPEFAFYDNTSFGLMRAEQRMLDLPGYLGSNEEDETTSTLSVEKLVI
Download sequence
Identical sequences ENSPTRP00000053487 ENSPTRP00000053487 9598.ENSPTRP00000053487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]