SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053525 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053525
Domain Number 1 Region: 3-295
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-78
Family Protein kinases, catalytic subunit 0.000000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053525   Gene: ENSPTRG00000008175   Transcript: ENSPTRT00000015073
Sequence length 315
Comment pep:known chromosome:CHIMP2.1.4:16:57249006:57282838:-1 gene:ENSPTRG00000008175 transcript:ENSPTRT00000015073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNI
IKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMH
RDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLD
MWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILG
QHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQP
CADNAVLSSGLTAAR
Download sequence
Identical sequences ENSMMUP00000020899 ENSPTRP00000053525 9544.ENSMMUP00000020899 9598.ENSPTRP00000053525 ENSPTRP00000053525 ENSMMUP00000020899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]