SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053604 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053604
Domain Number 1 Region: 26-209
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.29e-38
Family G proteins 0.0000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053604   Gene: ENSPTRG00000005729   Transcript: ENSPTRT00000010550
Sequence length 242
Comment pep:known chromosome:CHIMP2.1.4:13:26842728:26845679:1 gene:ENSPTRG00000005729 transcript:ENSPTRT00000010550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLSMSGHFLLAPIPESSSDYLLPKDIKLAVLGAGRVGKSAMIVRFLTKRFIGDYEPNT
GKLYSRLVYVEGDQLSLQIQDTPGGVQIQDSLPQVVDSLSKCVQWAEGFLLVYSITDYDS
YLSIRPLYQHIRKVHPDSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSE
NYEDVCDVFQHLCKEVSKMHGLSGERRRASIIPRPRSPNMQDLKRRFKQALSPKVKAPSA
LG
Download sequence
Identical sequences G1QHL1 H2NJH1 H2RA85 Q6T310
ENSP00000241463 ENSP00000241463 9598.ENSPTRP00000053604 9600.ENSPPYP00000005961 9606.ENSP00000241463 ENSP00000241463 ENSPTRP00000053604 ENSPPYP00000005961 ENSNLEP00000000398 ENSPTRP00000053604 gi|45592963|ref|NP_996563.1| NP_996563.1.87134 NP_996563.1.92137 XP_002824153.1.23681 XP_003270256.1.23891 XP_003818388.1.60992 XP_009425048.1.37143 ENSPPYP00000005961 ENSNLEP00000000398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]