SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053729 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053729
Domain Number 1 Region: 20-260
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-71
Family Protein kinases, catalytic subunit 0.00000999
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053729   Gene: ENSPTRG00000015873   Transcript: ENSPTRT00000029635
Sequence length 389
Comment pep:novel chromosome:CHIMP2.1.4:4:5114894:5579494:1 gene:ENSPTRG00000015873 transcript:ENSPTRT00000029635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGNHSHKPPVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDTKKMYAMKYMNKQKCI
ERDEVRNVFRELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTE
GTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEHGHVHITDFNIATVVKGAERASSM
AGTKPYMAPEVFQVYMDGGPGYSYPVDWWSLGITAYELLRGWRPYEIHSATPIDEILNMF
KVERVHYSSTWCKGMVALLRKINTNWDAVFQLMPGFVPNKGRLNCDPTFELEEMILESKP
LHKKKKRAKNRSRDGTKDSCPLNGHLQQCLETVRKEFIVFNREKLRRQQGQGSQLLDTDS
RGGGQAQSKLQDGYNNNLLTHTCTRGCSS
Download sequence
Identical sequences ENSPTRP00000053729 ENSPTRP00000053729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]