SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054216 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054216
Domain Number 1 Region: 1489-1653,1692-1840
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.39e-78
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0029
Further Details:      
 
Domain Number 2 Region: 38-225,264-407,494-632,1198-1362
Classification Level Classification E-value
Superfamily ARM repeat 2.16e-19
Family HspBP1 domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054216   Gene: ENSPTRG00000004250   Transcript: ENSPTRT00000061675
Sequence length 1922
Comment pep:known chromosome:CHIMP2.1.4:11:106143675:106230913:1 gene:ENSPTRG00000004250 transcript:ENSPTRT00000061675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHSAENPEPLDEIYNRKSVLLTLIAVVLSCSPICEKQALFALCKSVKENGLEPHLVKKVL
EKVSETFGYRRLEDFMASHLDYLVLEWLNLQDTEYNLSSFPFILLNYTNIEDFYRSCYKV
LIPHLVIRNHFDEVKSIANQIQEDWKSLLTDCFPKILVNILPYFAYEGTGDSGMAQQRET
ATKVYDMLKSENLLGKQIDHLFISNLPEIVVELLMTLHEPANSSASQSTYLYDFSGDLDP
APNPPHFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYK
KHRILKIYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINQRPSCIMDVSLHSFSLC
CDLLSQVCQTAVTYCKDALENHLHVIVGTLIPLVYEQVEVQKQVLDLLKYLVIDNKDNEN
LYLTIKLLDPFPDHVVFKDLRITQQKIKYSRGPFSLLEEINHFLSVSVYDALPLTRLEGL
KDLRRQLELHKDQMVDIMRASQDNPQDGIMVQLVVNLLQLSKMAINHTGEKEVLEAVGSC
LGEVGPIDFSTIAIQHSKDASYTKALKLFEDKELQWTFIMLTYLNNTLVEDCVKVRSAAV
TCLKNILATKTGHSFWEIYKMTTDPMLAYLQPFRTSRKKFLEVPRFDKENPFEGLDDTNL
WIPLSENHDIWIKTLTCAFLDSGGTKCEILQLLKPMCEVKTDFCQTVLPYLIHDILLQDT
NESWRNLLSTHVQGFFTSCLRHFSQTSRSTTPANLDSESEHFFRCCLDKKSQRTMLAVVD
YMRRQKRPSSGTIFNDAFWLDLNYLEVAKVAQSCAAHFTALLYAEIYADKKSMDDQEKRS
LAFEEGSQSTTISSLSEKSREETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPITRLR
TYEHEAMWGKALVTYDLETAIPSSTRQAGIIQALQNLGLCHILAVYLKGLDYENKDWCPE
LEELHYQAAWRNMQWDHCTSVSKEVEGTSYHESLYNALQSLRDREFSTFYENLKYARVKE
VEELCKRSLESVYSLYPTLSRLQAIGELESIGELFSRSVTHRQLSEVYIKWQKHSQLLKD
SDFSFQEPIMALRTVILEILMEKEMDNSQRECIKDILTKHLVELSILARTFKNTQLPERA
IFQIKQYNSVSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAANNPSLKLTY
TECLRVCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFS
DTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRA
LKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTY
KFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTK
PEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLD
ATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAG
GVNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICT
YKVVPLSQRSGVLEWCTGTVPIGEFLVNNEDGAHKRYRPNDFSAFQCQKKMMEVQKKSFE
EKYEVFMDVCQNFQPVFRYFCMEKFLDPAIWFEKRLAYTRSVATSSIVGYILGLGDRHVQ
NILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKT
MEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRN
LSDIDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAIDPKNLSRLFPGWKA
WV
Download sequence
Identical sequences ENSPTRP00000054216 ENSPTRP00000054216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]