SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054231 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054231
Domain Number 1 Region: 616-642,673-912
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.15e-62
Family Nuclear receptor ligand-binding domain 0.00000000126
Further Details:      
 
Domain Number 2 Region: 563-640
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-23
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054231   Gene: ENSPTRG00000004206   Transcript: ENSPTRT00000061688
Sequence length 932
Comment pep:known chromosome:CHIMP2.1.4:11:98883307:98976054:-1 gene:ENSPTRG00000004206 transcript:ENSPTRT00000061688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSNEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQGVLSPLMSRSGCKAGDSSGTAA
AHKVLPRGLSPSRQLLLPASGSPHCSGAPVKPSPQPAAVEVEEEDGSESEESAGPLLKGK
PRALGGAAAGGGTAVVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPRRSPLATTM
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAVSAFAPPRSSPSASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEERREASARSPRSYLCGRCHPAAXXXXXXX
XXXXXXXXXXXXXXXXXVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCK
APGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPY
LNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNY
LCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPVG
IPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQL
GERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPD
LILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQF
EEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRAL
SVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences ENSPTRP00000054231 ENSPTRP00000007237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]