SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000055958 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000055958
Domain Number 1 Region: 23-120
Classification Level Classification E-value
Superfamily Immunoglobulin 7.96e-19
Family I set domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000055958   Gene: ENSPTRG00000011457   Transcript: ENSPTRT00000064405
Sequence length 287
Comment pep:known chromosome:CHIMP2.1.4:19:59283626:59293896:-1 gene:ENSPTRG00000011457 transcript:ENSPTRT00000064405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPHPTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVIPQGSHVTFVCRGPVGVQTFRL
ERESRSTYNDTEDVSQASPSESEARFRIDSVSEGNAGLYRCIYYKPPKWSEQSDYLELLV
KETSGGPDSPDTEPGSSAGPTQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFLFCLLL
LVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLTVDVLERTADKATVNGLPKKDRETDSSA
LAAGSSQEVTYAQLDHWALTQRTARAVSPRSTKPMAESITYAAVARH
Download sequence
Identical sequences A0A2I3RZ94
ENSPTRP00000055958 ENSPTRP00000055958 9598.ENSPTRP00000019692 XP_512892.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]