SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056300 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056300
Domain Number 1 Region: 25-115
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000559
Family FHA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056300   Gene: ENSPTRG00000034166   Transcript: ENSPTRT00000064737
Sequence length 161
Comment pep:known chromosome:CHIMP2.1.4:5:136142765:136146295:-1 gene:ENSPTRG00000034166 transcript:ENSPTRT00000064737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPLTVLRVSLYHPTLGPSAFANVPPRLQHDTSPLLLGRGQDAHLQLQLPHLSRRHLSL
EPYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGT
SLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQEQPPPGSG
Download sequence
Identical sequences A0A2J8LRN2
ENSPTRP00000056300 9598.ENSPTRP00000056300 ENSPTRP00000056300 XP_003829308.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]