SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056495 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056495
Domain Number 1 Region: 315-364,396-521
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000399
Family Protein kinases, catalytic subunit 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056495   Gene: ENSPTRG00000033741   Transcript: ENSPTRT00000064933
Sequence length 646
Comment pep:known chromosome:CHIMP2.1.4:1:206130179:206175197:1 gene:ENSPTRG00000033741 transcript:ENSPTRT00000064933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQG
QDKHEEYFAENFDGPEGEFHFSVPQAAGASTDFSSASAPDQSAPPPLGHAHSEGPAPAYV
ASGPFREAGFPGQASSPLGRANGRLFANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEK
ARQAKARPENKQHKQTLSEHARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRSE
DPSGKKAVLGSSPFLSEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERV
RQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQ
YPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRD
LLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELF
EFHFMQTDPNWSNFFYDPQQHKVALDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKS
IEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLVP
PPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ
Download sequence
Identical sequences ENSPTRP00000056495 ENSPTRP00000056495 9598.ENSPTRP00000056495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]