SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056512 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056512
Domain Number 1 Region: 246-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000294
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056512   Gene: ENSPTRG00000014524   Transcript: ENSPTRT00000064950
Sequence length 402
Comment pep:known chromosome:CHIMP2.1.4:22:48770759:48780105:1 gene:ENSPTRG00000014524 transcript:ENSPTRT00000064950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAW
EEKTLSKYESSEIRLLEILEGLCESSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFC
VKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDC
MDGYFSSLRNETHSICTVRTGLSDSYPPCCLSLGCWRGVGHAWIRGRNTHTQPGYSSRVW
IAAFSPACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNAN
GSYTCEECDSSCVGCTGEGPGNCKECISGYAREHGQCADVDECSLAEKACVRKHENCYNT
PGSYVCVCPDGFEETEDACVPPAEAEATEGESPTQLPSREDL
Download sequence
Identical sequences H2RBY8
XP_001139663.1.37143 ENSPTRP00000056512 ENSPTRP00000056512 9598.ENSPTRP00000056512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]