SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056632 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056632
Domain Number 1 Region: 253-405
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 143-251
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-23
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 3 Region: 57-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-21
Family First domain of FERM 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000056632
Domain Number - Region: 491-555
Classification Level Classification E-value
Superfamily Prefoldin 0.034
Family Prefoldin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056632   Gene: ENSPTRG00000015098   Transcript: ENSPTRT00000065065
Sequence length 1034
Comment pep:known chromosome:CHIMP2.1.4:3:70432807:70651236:-1 gene:ENSPTRG00000015098 transcript:ENSPTRT00000065065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLQDVYQMTEGRH
CQVHLLDDRRLELLVQPKLLARELLDLVASHFNLKEKEYFGITFIDDTGQQNWLQLDHRV
LDHDLPKKPGPTILHFAVRFYIESISFLKDKTTVELFFLNAKACVHKGQIEVDSETIFKL
AAFILQEAKGDYTSDENARKDLKTLPAFPTKTLQEHPSLAYCEDRVIEHYLKIKGLTRGQ
AVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDIQDKVKPRKLFQWKQLE
NLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMAISQHQFYLDR
KQSKAKIPSARSLDEIAMDLTETGTQRASKLVTLEAKSQFIMASNGSLISSGSQDSEVSE
EQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNIGEKPPQVRRR
VGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTD
AMKKLQEIENSINEYRIRCGKKPSQKATVLPEDIIPSESSSLSDTTTYDDPSDAFTLPGQ
RSSSVPHSPRILPPKSLGIERIHFRKSSISEQFVDTRQSREMLSTHSSPYKTLERRPQGG
RSMPTTPVLTRNAYSSSHLEPQSSSQHCRQRSGSLESQSHLLSEMDSDKPFFSLSKSQRS
SSTEILDDGSSYTSQSSTEYYCVTPVTGPYYTTQTLDTRTRGRRRSKKQNVSTSNSGSMP
NLAQKDSLRNGVYSKSQEPPSSSYYIAGYTPYAECDFYYSGGYVYENDTEGQYSVNPSYR
SSAHYGYERQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHLR
GWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRASSYSSVSSTNASGNW
RTQLTIGLSDYETPAHSSYTSCYGNVYNPLPSPSRQYTEISQLDGTDGNRLEDNLESSEQ
RLFWHEDSKPGTLV
Download sequence
Identical sequences A0A2I3TEC6
XP_003811628.1.60992 XP_516575.3.37143 ENSPTRP00000056632 ENSPTRP00000056632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]