SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056686 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056686
Domain Number 1 Region: 396-499
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-31
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056686   Gene: ENSPTRG00000034232   Transcript: ENSPTRT00000065121
Sequence length 512
Comment pep:known scaffold:CHIMP2.1.4:GL391837.1:3517408:3526178:1 gene:ENSPTRG00000034232 transcript:ENSPTRT00000065121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPGAVGESDCPAEAREKMEQKEGKPSEDGTTVSPAADNPEMSEGGAPAEETKGTAGKAI
NEGPPTESGKQEKAPAEDGMSAELQGEANGLDEVKVESQREAGGKEDAEAELKKEDGEKE
ETTVGSQEMTGRKEETKSEPKEAEEKESTLASEKQKAEEKEAKPESGQKADANDRDKPEP
KATVEEEEAKTSSQEETGQRKECSTEPKEKATDEEAKAESRKAVVEDEAKAEPKEPDGKE
EAKHGAKEEADAKEEVEEAEEAEPGSPSEEQEQDVEKEPEGGAGVIPSSPEEWPESPTGE
GHNLSTDGLGPDSVASGQTSPSASESSPSDVPQSPPESPPSGEKKEKAPERRVSAPARPR
GPRAQNRKAIVDKFGGAASGPTALFRNTKAAGAAIGGVKNMLLEWCRAMTKKYEHVDIQN
FSSSWSSGMAFCALIHKFFPDAFDYAELDPAKRRHNFTLAFSTAEKLADCAQLLDVDDMV
RLAVPDSKCVYTYIQELYRSLVQKGLVKTKKK
Download sequence
Identical sequences ENSPTRP00000056686 ENSPTRP00000056686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]