SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056841 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056841
Domain Number 1 Region: 355-480
Classification Level Classification E-value
Superfamily TIMP-like 1.22e-21
Family Tissue inhibitor of metalloproteinases, TIMP 0.043
Further Details:      
 
Domain Number 2 Region: 45-96
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056841   Gene: ENSPTRG00000023147   Transcript: ENSPTRT00000065275
Sequence length 481
Comment pep:known chromosome:CHIMP2.1.4:19:1456287:1462721:-1 gene:ENSPTRG00000023147 transcript:ENSPTRT00000065275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKLRPGRVEWLASGHTERPRLFQNLLLFLWALLNCGLGVSAQGPGEWTPWVSWTRCSSS
CGRGVSVRSRRCLRLPGEEPCWGDSHEYRLCQLPDCPPGAVPFRDLQCALYNGRPVLGTQ
KTYQWVPFHGAPNQCDLNCLAEGHAFYHSFGRVLDGTACSPGAQGVCVAGRCLSAGCDGL
LGSGALEDRCGRCGGANDSCLFVQRVFRDAGAFAGYWNVTLILEGARHIRVEHRSRNHLA
LMGGDGRYVLNGDWAVSPPGTYEVAGTHVVYTRDTGPQETLQAAGPTSHDLLLQVLLQEP
NPGIEFEFWLPRERYSPFQARVQALGWPLRQPQPRGVEPQPPAAPAVTPARTPTLAPDPC
PPCPDTRGRAHRLLHYCGSDFVFQARVLSRHRQARETRYEVRIQLVYKNRSPLRAREYVW
APGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQLLLPHAGYARPWSPAEDSRIRLTARRCP
G
Download sequence
Identical sequences ENSPTRP00000056841 ENSPTRP00000056841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]