SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057000 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057000
Domain Number 1 Region: 89-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-85
Family Protein kinases, catalytic subunit 0.00000252
Further Details:      
 
Domain Number 2 Region: 977-1045
Classification Level Classification E-value
Superfamily G protein-binding domain 5.49e-26
Family RhoA-binding domain 0.0000417
Further Details:      
 
Domain Number 3 Region: 1149-1239,1316-1350
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000278
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 4 Region: 1258-1307
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000419
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000057000
Domain Number - Region: 437-544
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000915
Family Myosin rod fragments 0.0029
Further Details:      
 
Domain Number - Region: 553-657
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0243
Family Myosin rod fragments 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057000   Gene: ENSPTRG00000011658   Transcript: ENSPTRT00000065434
Sequence length 1388
Comment pep:known chromosome:CHIMP2.1.4:2A:11291146:11453480:-1 gene:ENSPTRG00000011658 transcript:ENSPTRT00000065434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWH
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCRENDSIQSRKNEVRIHIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKT
AKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKI
LLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
DAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS
Download sequence
Identical sequences ENSPTRP00000057000 ENSPTRP00000057000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]