SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057125 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000057125
Domain Number - Region: 116-244
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0173
Family Arfaptin, Rac-binding fragment 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057125   Gene: ENSPTRG00000014915   Transcript: ENSPTRT00000065561
Sequence length 595
Comment pep:known chromosome:CHIMP2.1.4:3:49966582:50028129:1 gene:ENSPTRG00000014915 transcript:ENSPTRT00000065561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFNVWNIKEMLSIPSGSGNKKSSNWNNNQNDYSSLSDSQFLFGSQFCPENSETLSAPLD
FGAHLRHSKQSQQNYLEGEPSIFTKYQTKPQLFGGDIKDGGVFPPPLSVGKSKGLLEQFE
EKKKRAKDKCDSETLYNFVSNVRESILRLQTSVEKSEDHLSSRSQSILDSLETVAKTLQE
TIQAQNDLVFEAVQDKGNMEQAILEMKKRFEARQAEFIEMKSNLKHLEVLVAQQSQEFQQ
LCEQLGQLNVPSVLAELKRLISVPPVKDSASQTSPPLAQSLNLTRQEKYTSEKPVLWQAQ
ALPAAWNPGMGSLQPGEFDVWGEGAKNDALQEEAALPAFGSHERNRHVKDKAVQTNCKNW
AVTKTGAKNHGSSIPGHKIPSDRDLVSQGASHLTSLEINNFSTSIKNACQKYQAQSMFLC
DPRKHLVIKQKDGTVEMRGKDKKQQPRKAHRAHRGRLIASKQKQIPIQTCKFNSKYQSPQ
PAISVPQSPFLGQQEPHAQPLHLQCPRSPRKPVCPILGGTVMPNKTVRAVQGRLLQLSRC
SSQDNWLLSSSSQGDHQMSWFSDLNLGCSETPLCKEAGKNLLYDLGFDSSDDDGF
Download sequence
Identical sequences ENSPTRP00000057125 ENSPTRP00000057125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]