SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057993 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057993
Domain Number 1 Region: 14-292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-77
Family Protein kinases, catalytic subunit 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057993   Gene: ENSPTRG00000018427   Transcript: ENSPTRT00000066415
Sequence length 606
Comment pep:known chromosome:CHIMP2.1.4:6:91170492:91240761:-1 gene:ENSPTRG00000018427 transcript:ENSPTRT00000066415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
Download sequence
Identical sequences A0A0D9RXG7 A0A1U7TCL6 A0A2K5HLC8 A0A2K5WQB4 A0A2K5ZSU5 A0A2K6D8Q7 A0A2K6K1Q7 A0A2K6PEC2 E2R3R6 F7H6S1 H2RCY2 O43318
NP_663304.1.87134 NP_663304.1.92137 XP_001160579.1.37143 XP_003822933.1.60992 XP_004044463.1.27298 XP_005552391.1.63531 XP_005627696.1.84170 XP_008004833.1.81039 XP_008055565.1.4292 XP_008685908.1.72690 XP_010356055.1.97406 XP_011765475.1.29376 XP_011797331.1.43180 XP_011797332.1.43180 XP_011839804.1.47321 XP_011839805.1.47321 XP_014992423.1.72884 XP_017743732.1.44346 ENSPTRP00000057993 ENSPTRP00000057993 ENSP00000358335 ENSCAFP00000004664 9544.ENSMMUP00000008581 9598.ENSPTRP00000057993 9606.ENSP00000358335 9615.ENSCAFP00000004666 ENSP00000358335 ENSCAFP00000004664 ENSMMUP00000008581 HR3589 ENSGGOP00000020634 gi|21735562|ref|NP_663304.1| ENSGGOP00000020634 ENSMMUP00000008581 ENSP00000358331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]