SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000058206 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000058206
Domain Number 1 Region: 72-239,285-394
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.65e-48
Family Calponin-homology domain, CH-domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000058206   Gene: ENSPTRG00000014480   Transcript: ENSPTRT00000066625
Sequence length 396
Comment pep:novel chromosome:CHIMP2.1.4:22:42767726:42937831:1 gene:ENSPTRG00000014480 transcript:ENSPTRT00000066625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHVFKDHQRGEKRGFLSPENKNCRRLELRRGCSCSRGLCSQALMASLAGSLLPGSDRSG
VETSEYAPGGVSDLQEEGKNAINSPMSPALADVHPEDTQLEENEERTMIDPTSKEDPKFK
ELVKVLLDWINDMLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQ
KLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQV
VVVRKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKH
LNKLNLEVTELETQFADGVYLVFMGLLEDYFVPLHPFYLTPESFDQKVHNVSFAFELMLD
GGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
Download sequence
Identical sequences ENSPTRP00000058206 ENSPTRP00000058206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]