SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000058378 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000058378
Domain Number 1 Region: 115-362
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-68
Family Nuclear receptor ligand-binding domain 0.00000000123
Further Details:      
 
Domain Number 2 Region: 47-129
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.56e-29
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000058378   Gene: ENSPTRG00000020357   Transcript: ENSPTRT00000066800
Sequence length 445
Comment pep:known chromosome:CHIMP2.1.4:8:73534701:73559020:1 gene:ENSPTRG00000020357 transcript:ENSPTRT00000066800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMANYSEVLDPTYTTLEFETMQILYNSNDSSAPETSMNTTDNGVNCLCAICGDRATGKH
YGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQ
NERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVCESM
KQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMYKDILLLGNNYVI
HRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMR
FQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQE
MLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSG
QEQYKIAANQASVISHQHLSKQKQL
Download sequence
Identical sequences A0A2J8M9U1
9598.ENSPTRP00000058378 ENSPTRP00000058378 ENSPTRP00000058378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]