SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059021 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059021
Domain Number 1 Region: 20-325
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-82
Family Protein kinases, catalytic subunit 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059021   Gene: ENSPTRG00000017379   Transcript: ENSPTRT00000067433
Sequence length 407
Comment pep:known chromosome:CHIMP2.1.4:5:148077746:148228910:1 gene:ENSPTRG00000017379 transcript:ENSPTRT00000067433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCV
ERNEVRNVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKE
ETVKLFICELAMALDYLQNQRIIHRDMKPDNILLDEHGHVHITDFNIAAMLPRETQITTM
AGTKPYMAPEMFSSRKGAGYSFAVDWWSLGVTAYELLRGRRPYHIRSSTSSKEIVHTFET
TVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP
NKGRLNCDPTFELEEMILESKPLHKKKKRLAKKEKDMRKCDSSQTCLLQEHLDSVQKEFI
IFNREKVNRDFNKRQPNLALEQTKDPQVTNGQMDTGLSETFQTSKVS
Download sequence
Identical sequences ENSPTRP00000059021 ENSPTRP00000059021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]