SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059441 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059441
Domain Number 1 Region: 20-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.87e-73
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 254-376
Classification Level Classification E-value
Superfamily Spectrin repeat 8.35e-34
Family Spectrin repeat 0.000000652
Further Details:      
 
Domain Number 3 Region: 490-611
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-31
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 4 Region: 377-485
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 5 Region: 614-726
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-22
Family Spectrin repeat 0.00000238
Further Details:      
 
Domain Number 6 Region: 725-827
Classification Level Classification E-value
Superfamily EF-hand 4.48e-19
Family EF-hand modules in multidomain proteins 0.0054
Further Details:      
 
Domain Number 7 Region: 830-900
Classification Level Classification E-value
Superfamily EF-hand 3.93e-18
Family EF-hand modules in multidomain proteins 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059441   Gene: ENSPTRG00000006477   Transcript: ENSPTRT00000067852
Sequence length 901
Comment pep:known chromosome:CHIMP2.1.4:14:68040239:68147341:-1 gene:ENSPTRG00000006477 transcript:ENSPTRT00000067852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKAGTQIEIEEDFRDGLKLMLLLEVIS
GERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILR
FAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDY
GKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQ
KAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKL
EDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQ
VEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKAL
LKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKR
REALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQ
FKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPR
RDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQ
YEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVEN
QILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQKKTGMM
DTDDFRACLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMA
SFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESD
L
Download sequence
Identical sequences ENSPTRP00000059441 ENSPTRP00000059441 9598.ENSPTRP00000059441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]