SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059866 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059866
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2e-36
Family Calponin-homology domain, CH-domain 0.000000621
Further Details:      
 
Domain Number 2 Region: 145-194
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000000471
Family EB1 dimerisation domain-like 0.0000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059866   Gene: ENSPTRG00000042207   Transcript: ENSPTRT00000076204
Sequence length 194
Comment pep:novel chromosome:CHIMP2.1.4:8:134362414:134363159:-1 gene:ENSPTRG00000042207 transcript:ENSPTRT00000076204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINSLQLNVTKIEQLCSGAACQFMDMLFPGSTALKKVK
FAKLEHGCIQNFKILPVGFKRMGVDKIIPVDKLVKGKFQENFEFVQWFKKFFDANYDGKD
DPVAARQGQETAVAPSLVAPALNTPKKLKLTVEDLEKERDFYFGKLNIELICQENEGEND
PVLQRIVDILYATD
Download sequence
Identical sequences ENSPTRP00000059866 ENSPTRP00000059866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]