SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060606 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000060606
Domain Number - Region: 25-55
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0275
Family TSP-1 type 1 repeat 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060606   Gene: ENSPTRG00000039802   Transcript: ENSPTRT00000073619
Sequence length 109
Comment pep:novel chromosome:CHIMP2.1.4:20:60065673:60071461:-1 gene:ENSPTRG00000039802 transcript:ENSPTRT00000073619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAGLELEQEAEGLVMPALPSAWLHQAALWERRPWNACSFTAGREHGPRCPQVPAQIQSEP
AGQPESPPKVPQPGAHPGRRAGAGAGADGRRTHQGPGVNNAPLEKLRTG
Download sequence
Identical sequences ENSPTRP00000060606 ENSPTRP00000060606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]