SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060618 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060618
Domain Number 1 Region: 21-73
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000138
Family Extracellular domain of cell surface receptors 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060618   Gene: ENSPTRG00000039696   Transcript: ENSPTRT00000076095
Sequence length 75
Comment pep:known chromosome:CHIMP2.1.4:11:123816759:123821927:1 gene:ENSPTRG00000039696 transcript:ENSPTRT00000076095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKMNTLLLVSLSFLYLKEGIAKENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGL
LRVTLCCDRNFCNVF
Download sequence
Identical sequences ENSPTRP00000060618 ENSPTRP00000060618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]