SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060844 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060844
Domain Number 1 Region: 513-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-61
Family Protein kinases, catalytic subunit 0.00000375
Further Details:      
 
Domain Number 2 Region: 219-407
Classification Level Classification E-value
Superfamily Fibronectin type III 6.05e-26
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 3 Region: 43-134
Classification Level Classification E-value
Superfamily Immunoglobulin 6.83e-16
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 
Domain Number 4 Region: 134-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000988
Family I set domains 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060844   Gene: ENSPTRG00000039189   Transcript: ENSPTRT00000073141
Sequence length 876
Comment pep:novel chromosome:CHIMP2.1.4:15:73812537:73815112:-1 gene:ENSPTRG00000039189 transcript:ENSPTRT00000073141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRHSMGRLGLLLLPPQQLGLLLVALASLLLPESAAAGLKLVGVPAKLTVSQGQLVKLN
CSVEGMEEPDIQWVKDGAVVQNLDQFIPVSEQHWISFLSLKSVERSDTGQYWCKVDGGEI
QISQPVWLTVVGVPLFTVEPKDLAVPPNAPFQLSCKAVGPPEPVTIVWWRGTTKIGGPAP
SPFVLNVTGVTQSTMFSCEVHSLKCLASSRIATVLLQALPAVPFNITVTKLSSGNTSVAW
MPGADGQALLQSCTVQVTQAPGGWEVLAVVVLVPPFTCLLRDLVPATSYSLRVCCASALG
PSPYADWVPFQTKGLAPASAPQNLHAIHTDSGLILEWEEVIPEGPLEGPLGPYKLSWVQD
NGTQDELTMEGTRANLTGWDPQKGLIIRVCVSNAVGCGPWSQPLVVSSHDHAGQKGPPHS
RTSWVPVVLGVLTALVMAAALSLILLRKRPKETWFGQGFDSVIARGEPAIHFWAARSFNR
ERPKRIEATLDSLGINSELKEKLEDVLIPEQQFTGRILGKGEFGSVRAQLKQEDGSFVKV
AMKMLKADLIASSDIEEFLRKAACMKEFDHPHVAKLVGEPLSLWSRAKGCHPIPMVILPF
MKHGDLHAFLLTSRLGENPFTLIRFMVDIACGMEYLSSRNFIHRDLATRNCMLAEDMTVC
VADFGLSWKIYSGYYCQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQT
PYAGIENTEIYNYLIGGNRLKQLPECMEDDLMYQCWSADPKQRPSFTCLRMELENILGQL
SVLSACQDPLYINIERAEEPTVGGSLELPSGDQPYSGSGDGSGMGTVGGTPSDCYILTPG
GLAEQPGQAEHQPESPLNETQRLLLQQQGLLPHNSC
Download sequence
Identical sequences ENSPTRP00000060844 ENSPTRP00000060289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]