SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061113 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000061113
Domain Number - Region: 123-180
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0033
Family Snake venom toxins 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061113   Gene: ENSPTRG00000040973   Transcript: ENSPTRT00000073976
Sequence length 237
Comment pep:known scaffold:CHIMP2.1.4:GL389173.1:72741:81839:-1 gene:ENSPTRG00000040973 transcript:ENSPTRT00000073976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGILVAGITAVLVAAVESLSCVQCNSWEKPCVNSIASECPSHANTSCISSSASSSLETP
VRLYQNMFCSAENCSEETHITAFTVHVSAEEHFHFVSQCCQGKECSNTSDALDPPLKNVS
SNAECPACYESNGTSCHGKPWKCYEEGQCVFLVAELKNDIESKSLVLKGCSNVSNATCQF
LSGENKTLGGVIFRKFECANVNSLTPTSAPTTSHNVGSKASLYLLALASLLLLGLLP
Download sequence
Identical sequences A0A2I3SXA1
ENSPTRP00000061113 ENSPTRP00000061113 XP_016798016.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]