SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061235 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061235
Domain Number 1 Region: 38-347
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-93
Family Protein kinases, catalytic subunit 0.0000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061235   Gene: ENSPTRG00000038881   Transcript: ENSPTRT00000074297
Sequence length 358
Comment pep:known chromosome:CHIMP2.1.4:Y:25135734:25238580:-1 gene:ENSPTRG00000038881 transcript:ENSPTRT00000074297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPGPAQAAAAESNSREVAEDTADWAPALCPSPEARSPEAPAYRLQDFDALVTVGTGTF
GRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDEH
FLYMLMEYVPGGELFSYLRNQGCFSSTTGLFYSAEIICAMEYLHSKEIVYRDLEPENILL
DRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSG
FPPFFDENPLGIYQKILAGKLDFPRHLDFRVKDLIKKLLVVDRTRRLGNMKNGANDMKRH
RWFRSVDWEAVPQRKLKPPIVPTTAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF
Download sequence
Identical sequences H2RI77
ENSPTRP00000061235 ENSPTRP00000061235 NP_001180591.1.37143 XP_016800143.1.37143 XP_016800144.1.37143 XP_016800145.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]