SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000585 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000585
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 4.05e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000000585
Domain Number - Region: 548-608
Classification Level Classification E-value
Superfamily F-box domain 0.0203
Family F-box domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000585   Gene: ENSPTRG00000000335   Transcript: ENSPTRT00000000660
Sequence length 747
Comment pep:known chromosome:CHIMP2.1.4:1:23760747:23772391:1 gene:ENSPTRG00000000335 transcript:ENSPTRT00000000660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLKYLKKLSTLPITVDILAETGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPD
EQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKV
SHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMYVDHYRSLEEDQEPIV
SHQKPGKGHSNAFQDRLGASQERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASV
VSREKSHKALSKEENRRPPSGDSAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHL
KKPKHRDPEKAKLDKSKQGLDSFDTGKGAGDLLPKVKEKGSNNVKTPEGKVKTNSDRKSL
GSLPKVEETDMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTG
KNLDSVQKLPKVNKTKSEKPAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELIS
SFQPKRKAFSSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHQQCIRVLKNNIDS
IFEVGGVPYSVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYES
WREMYLRLQDAREQRLRVLTKNIQFAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGT
GGAAIPEKIKIKPAPYPTGSSHASSSSNSFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYD
PRKPTVKKIAPMMAKTIKAFKNRFSRR
Download sequence
Identical sequences 9598.ENSPTRP00000000585 ENSPTRP00000000585 ENSPTRP00000000585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]