SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000981 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000981
Domain Number 1 Region: 188-254
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.48e-20
Family LIM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 129-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.58e-18
Family LIM domain 0.00083
Further Details:      
 
Domain Number 3 Region: 7-71
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000286
Family LIM domain 0.018
Further Details:      
 
Domain Number 4 Region: 67-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000265
Family LIM domain 0.0023
Further Details:      
 
Domain Number 5 Region: 251-277
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000272
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000981   Gene: ENSPTRG00000000560   Transcript: ENSPTRT00000001089
Sequence length 280
Comment pep:known chromosome:CHIMP2.1.4:1:38233249:38242036:-1 gene:ENSPTRG00000000560 transcript:ENSPTRT00000001089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESFDCAKCSESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRH
FHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQ
TWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQP
WHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFE
DRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Download sequence
Identical sequences A0A0D9S7Q3 A0A1D5QLX7 A0A2I3LU28 A0A2K5MFS1 A0A2K6AER6 F6YQN7 G1RM43 G3QK59 G7NUB3 H2N7X1 H2PYQ1
NP_001252603.1.72884 XP_002811062.1.23681 XP_002811063.1.23681 XP_003273347.1.23891 XP_003273348.1.23891 XP_003308038.1.37143 XP_004025544.1.27298 XP_007977513.1.81039 XP_007977514.1.81039 XP_008966708.1.60992 XP_008966709.1.60992 XP_009452419.1.37143 XP_009452422.1.37143 XP_011934784.1.92194 XP_011934785.1.92194 XP_014991054.1.72884 XP_017830066.1.60252 XP_513331.2.37143 ENSMMUP00000030540 ENSMMUP00000030540 ENSPANP00000003377 ENSCJAP00000004027 ENSPPYP00000001754 ENSPTRP00000000981 ENSCJAP00000004027 ENSNLEP00000014307 ENSNLEP00000014307 ENSPTRP00000000981 ENSGGOP00000002827 9544.ENSMMUP00000030540 9598.ENSPTRP00000000981 9600.ENSPPYP00000001754 ENSGGOP00000002827 ENSPPYP00000001754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]