SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003228 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003228
Domain Number 1 Region: 112-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.18e-16
Family Complement control module/SCR domain 0.00036
Further Details:      
 
Domain Number 2 Region: 173-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.00033
Further Details:      
 
Domain Number 3 Region: 232-295
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000175
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 426-488
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 483-541
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000639
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 6 Region: 50-117
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000848
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 7 Region: 299-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000278
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 8 Region: 365-430
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000104
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003228   Gene: ENSPTRG00000001927   Transcript: ENSPTRT00000003509
Sequence length 597
Comment pep:known chromosome:CHIMP2.1.4:1:186207311:186247949:1 gene:ENSPTRG00000001927 transcript:ENSPTRT00000003509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAV
PVDITLTETHFKTGTTLKYTCRPGYVRSHSTQTLTCNSDGEWVYNTFCIHKRCRHPGELR
NGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSHCEVQDRGVGWSHPLPQCEIVKCKPPPD
IRNGRHSGEENFYAYGFSVTYSCDHRFSLLGHASISCTVENETIGVWRPSPPTCEKITCD
KPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCT
NLPDIPHASWETYPRPTKEDVYVVGTLLRYRCHPGYKPTTDEPMTVICQKNLRWTPYQGC
EALCCPEPTLNNGEITQHRKSHPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTP
SCGDICNFHPKIAHGHYKQSSSYSFFKEEITYECDKGYILVGQAKLSCSYSRWSAPAPQC
KALCLKPELLNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSENRTWYPEVPKCEW
ETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQYTLDKEL
Download sequence
Identical sequences H2Q114
ENSPTRP00000003228 ENSPTRP00000003228 9598.ENSPTRP00000003228 XP_009439670.1.37143 XP_009439671.1.37143 XP_514156.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]