SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004072 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004072
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 5.63e-48
Family C-type lysozyme 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004072   Gene: ENSPTRG00000029912   Transcript: ENSPTRT00000004412
Sequence length 194
Comment pep:known chromosome:CHIMP2.1.4:10:31078724:31096666:-1 gene:ENSPTRG00000029912 transcript:ENSPTRT00000004412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRHGKLKENNHCHVACSALITDDLTDAIICAKKIVKETQGMNYWQGWKKHCE
GRDLSEWKKGCEVS
Download sequence
Identical sequences A0A080YV04
ENSPTRP00000004072 9598.ENSPTRP00000004072 ENSPTRP00000004072 XP_001137565.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]