SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004481 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004481
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.7e-108
Family Inorganic pyrophosphatase 0.0000000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004481   Gene: ENSPTRG00000002585   Transcript: ENSPTRT00000004860
Sequence length 289
Comment pep:known chromosome:CHIMP2.1.4:10:68705127:68736056:-1 gene:ENSPTRG00000002585 transcript:ENSPTRT00000004860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKP
GYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGI
SCMNTTVSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
Download sequence
Identical sequences H2Q212
XP_001164495.2.37143 XP_003815991.1.60992 9598.ENSPTRP00000004481 ENSPTRP00000004481 ENSPTRP00000004481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]