SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004835 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004835
Domain Number 1 Region: 66-207
Classification Level Classification E-value
Superfamily L domain-like 5.83e-35
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000004835
Domain Number - Region: 342-548
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000934
Family WD40-repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004835   Gene: ENSPTRG00000002771   Transcript: ENSPTRT00000005231
Sequence length 557
Comment pep:known chromosome:CHIMP2.1.4:10:93322483:93363694:1 gene:ENSPTRG00000002771 transcript:ENSPTRT00000005231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESERSKRMGNACIPLKRIAYFLCLLSALLLTEGKKPAKPKCPAVCTCTKDNALCENARS
IPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYL
FIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCK
LKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSID
TFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVA
QLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIY
KWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQSF
TNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQ
PLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASS
FKGNTQIYKHVIVDLSA
Download sequence
Identical sequences A0A2J8PE37 Q1EGL2
NP_001065246.1.37143 ENSPTRP00000004835 9598.ENSPTRP00000004835 ENSPTRP00000004835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]