SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006235 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006235
Domain Number 1 Region: 279-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-43
Family SPRY domain 0.00021
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-16
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 85-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000058
Family B-box zinc-binding domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000006235
Domain Number - Region: 179-244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0115
Family Spectrin repeat 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006235   Gene: ENSPTRG00000003587   Transcript: ENSPTRT00000006757
Sequence length 452
Comment pep:known scaffold:CHIMP2.1.4:GL391862.1:23503:29860:-1 gene:ENSPTRG00000003587 transcript:ENSPTRT00000006757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGILQVFQRELICPMCMNYFIDPVTIDCGHSFCRPCFYLNWQDIPFLVQCSECTKSAE
QINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTLRETKKIFCEVDRSLLCLLCSSSQE
HRYHRHRPIEWAAEEHREKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIR
AEYQKMPAFHHEEEKQNLEMLKKKGKEIFHRLHLSKAKMAHRMEILRGMYEELNEMCHKP
DVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANSDT
FLYEILRSMCIGCDHQDVPYFTATPRSFLAWGAQTFTSGKYYWEVHVGDSWNWAFGVCNM
YWKEKNQNEKIDGEEGLFLLGCVKNDIQCSLFTTSPLMLQYIPKPTSRVGLFLDCEAKTV
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF
Download sequence
Identical sequences ENSPTRP00000006235 ENSPTRP00000059923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]